![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Traes_1DL_58BEEDC49.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
|
||||||||
Family | FAR1 | ||||||||
Protein Properties | Length: 64aa MW: 7528.77 Da PI: 5.0194 | ||||||||
Description | FAR1 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | FAR1 | 31.1 | 7.9e-10 | 25 | 64 | 1 | 40 |
FAR1 1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegk 40 +fYn+YA e GFsvrks+ + n+ i+ r+ vC ++g+ Traes_1DL_58BEEDC49.1 25 EFYNKYALEKGFSVRKSYVEWDGSNKYIILRKIVCXRZGF 64 6*************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03101 | 1.1E-7 | 25 | 64 | IPR004330 | FAR1 DNA binding domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 64 aa Download sequence Send to blast |
ASDASMFEYL NVVSKMFDSE AEGYEFYNKY ALEKGFSVRK SYVEWDGSNK YIILRKIVCX 60 RZGF |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG670306 | 4e-91 | HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010231784.2 | 9e-23 | PREDICTED: protein FAR1-RELATED SEQUENCE 5-like | ||||
TrEMBL | W5AF11 | 5e-39 | W5AF11_WHEAT; Uncharacterized protein | ||||
STRING | BRADI2G37795.1 | 3e-22 | (Brachypodium distachyon) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2449 | 9 | 76 |
Publications ? help Back to Top | |||
---|---|---|---|
|